AKAP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-53116

Product Code. 18205003

Description

AKAP7 Polyclonal specifically detects AKAP7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: AKAP7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 9465
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9P0M2
• Gene Symbols: AKAP7
• Immunogen: Synthetic peptides corresponding to AKAP7(A kinase (PRKA) anchor protein 7) The peptide sequence was selected from the middle region of AKAP7. Peptide sequence MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG