AKAP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89170

Product Code. 18276026

Description

AKAP7 Polyclonal specifically detects AKAP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AKAP7
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9P0M2
• Gene Symbols: AKAP7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
• Quantity: 0.1 mL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 9465
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only