missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AKAP7 Polyclonal specifically detects AKAP7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | AKAP7 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | A kinase (PRKA) anchor protein 7, AKAP 18, AKAP15, AKAP18A-kinase anchor protein 7 isoform alpha, AKAP-7 isoform gamma, AKAP-7 isoforms alpha and beta, A-kinase anchor protein 18 kDa, A-kinase anchor protein 7, A-kinase anchor protein 7 isoform gamma, A-kinase anchor protein 7 isoforms alpha and beta, A-kinase anchor protein 9 kDa, A-kinase anchor protein, 18-kD, A-kinase anchoring protein 18, protein kinase A anchoring protein 7, Protein kinase A-anchoring protein 7 isoform gamma, Protein kinase A-anchoring protein 7 isoforms alpha/beta |
| Gene Symbols | AKAP7 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HVNSLLEIAETANRTFQEKGILVGESRSFKPHLTFMKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKK |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?