missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18389129

AICL/CLEC-2B Antibody, Novus Biologicals™

Product Code. 18389129 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389129 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18389129 Supplier Novus Biologicals Supplier No. H00009976B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

AICL/CLEC-2B Polyclonal antibody specifically detects AICL/CLEC-2B in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen AICL/CLEC-2B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH05254
Gene Alias Activation-induced C-type lectin, AICLC-type lectin superfamily member 2, CLECSF2IFN-alpha-2b-inducing-related protein 1, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 2 (activation-induced), C-type lectin domain family 2 member B, C-type lectin domain family 2, member B, HP10085, IFN-alpha2b-inducing related protein 1, IFNRG1
Host Species Mouse
Immunogen CLEC2B (AAH05254, 1 a.a. - 149 a.a.) full-length human protein. MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 9976
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.