AHR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89974

Product Code. 18498365

Description

AHR Polyclonal antibody specifically detects AHR in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: AHR
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Ah receptor, AhR, AH-receptor, aryl hydrocarbon receptor, BHLHE76, bHLHe76aromatic hydrocarbon receptor, Class E basic helix-loop-helix protein 76
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLYSIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEI
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Breast Cancer, Cancer, Chromatin Research, Hypoxia, Innate Immunity, Transcription Factors and Regulators
• Gene ID (Entrez): 196
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified