missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AHCYL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57654
This item is not returnable.
View return policy
Description
AHCYL1 Polyclonal specifically detects AHCYL1 in Human samples. It is validated for Western Blot.
Specifications
| AHCYL1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| adenosylhomocysteinase-like 1, AdoHcyase 2, DCAL, DC-expressed AHCY-like molecule, dendritic cell expressed AHCY-like protein, inositol 14,5-trisphosphate receptor-binding protein, IRBIT, PRO0233, putative adenosylhomocysteinase 2, S-adenosyl homocysteine hydrolase homolog, S-adenosylhomocysteine hydrolase-like 1, S-adenosylhomocysteine hydrolase-like protein 1, S-adenosyl-L-homocysteine hydrolase 2, XPVKONAEC 3.3.1.1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10768 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O43865 | |
| AHCYL1 | |
| Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction