missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AHCYL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | AHCYL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AHCYL1 Polyclonal specifically detects AHCYL1 in Human samples. It is validated for Western Blot.Specifications
| AHCYL1 | |
| Polyclonal | |
| Rabbit | |
| O43865 | |
| 10768 | |
| Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| adenosylhomocysteinase-like 1, AdoHcyase 2, DCAL, DC-expressed AHCY-like molecule, dendritic cell expressed AHCY-like protein, inositol 14,5-trisphosphate receptor-binding protein, IRBIT, PRO0233, putative adenosylhomocysteinase 2, S-adenosyl homocysteine hydrolase homolog, S-adenosylhomocysteine hydrolase-like 1, S-adenosylhomocysteine hydrolase-like protein 1, S-adenosyl-L-homocysteine hydrolase 2, XPVKONAEC 3.3.1.1 | |
| AHCYL1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title