AGXT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18407321	Novus Biologicals NBP2-34198-25ul	25 μL
18143093	Novus Biologicals NBP2-34198	0.1 mL

Description

AGXT Polyclonal specifically detects AGXT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AGXT
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AGT1L-alanine: glyoxylate aminotransferase 1, AGThepatic peroxisomal alanine:glyoxylate aminotransferase, AGXT1, alanine-glyoxylate aminotransferase, Alanine--glyoxylate aminotransferase, EC 2.6.1.44, EC 2.6.1.51, PH1, serine:pyruvate aminotransferase, SPATserine-pyruvate aminotransferase, SPTserine--pyruvate aminotransferase, TLH6
• Gene Symbols: AGXT
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: P21549
• Gene ID (Entrez): 189
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only