missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AGTR-2 Monoclonal antibody specifically detects AGTR-2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | AGTR-2 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 0V7Y3 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Angiostensin Receptor, angiotensin II receptor, type 2, Angiotensin II type-2 receptor, angiotensin receptor 2, AT2ATGR2, MRX88type-2 angiotensin II receptor |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 264-363 of human AGTR-2 (P50052). AFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMETFVS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?