missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGPAT7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17567-25UL
This item is not returnable.
View return policy
Description
AGPAT7 Polyclonal antibody specifically detects AGPAT7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| AGPAT7 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| acyltransferase like 3, Acyltransferase-like 3, AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2, AYTL3lysophospholipid acyltransferase LPCAT4,1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase, eta), EC 2.3.1, EC 2.3.1.-, EC 2.3.1.23, FLJ10257,1-acylglycerol-3-phosphate O-acyltransferase 7, LPAAT-eta, LPEAT21-AGPAT 7, lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7, Lysophosphatidylethanolamine acyltransferase 2, PLSC domain containing protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEFARQLQLSDPQTVAGAFGYFQQDT | |
| 25 μg | |
| Lipid and Metabolism | |
| 254531 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction