missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Agpat4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79870
This item is not returnable.
View return policy
Description
Agpat4 Polyclonal specifically detects Agpat4 in Human samples. It is validated for Western Blot.
Specifications
| Agpat4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acidacyltransferase, delta), 1-AGP acyltransferase 4,1-acylglycerol-3-phosphate O-acyltransferase 4,1-AGPAT 4, dJ473J16.2,1-acyl-sn-glycerol-3-phosphate acyltransferase delta, EC 2.3.1.51, LPAAT-delta1-AGPAT4, Lysophosphatidic acid acyltransferase delta, lysophosphatidic acid acyltransferase-delta (LPAAT-delta) | |
| Rabbit | |
| 44 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Dog: 85%; Rat: 85%; Mouse: 85%; Guinea pig: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9NRZ5 | |
| AGPAT4 | |
| Synthetic peptide directed towards the middle region of human AGPAT4The immunogen for this antibody is AGPAT4 (NP_064518). Peptide Sequence: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM | |
| Affinity purified | |
| RUO | |
| 56895 | |
| Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction