missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AGPAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59734
This item is not returnable.
View return policy
Description
AGPAT2 Polyclonal specifically detects AGPAT2 in Human samples. It is validated for Western Blot.
Specifications
| AGPAT2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta), 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta), 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta, Berardinelli-Seip congenital lipodystrophy, BSCL, BSCL1, EC 2.3.1.51, LPAAB, LPAAT-beta, Lysophosphatidic acid acyltransferase beta, lysophosphatidic acid acyltransferase-beta | |
| Rabbit | |
| 27 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q5VUD3 | |
| AGPAT2 | |
| Synthetic peptides corresponding to AGPAT2(1-acylglycerol-3-phosphate O-acyltransferase 2 ) The peptide sequence was selected from the C terminal of AGPAT2. Peptide sequence LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA. | |
| Protein A purified | |
| RUO | |
| 10555 | |
| Human, Pig | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction