AGPAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38279-20ul

Product Code. 30232628

Description

AGPAT1 Polyclonal antibody specifically detects AGPAT1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western Blot

Specifications

• Antigen: AGPAT1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
• Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 204-283 of human AGPAT1 (NP_006402.1).,, Sequence:, PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10554
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG