missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AGO1/EIF2C1 Polyclonal antibody specifically detects AGO1/EIF2C1 in Human samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | AGO1/EIF2C1 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | AGO1Q99, argonaute 1, argonaute1, DKFZp686M13167, EIF2C, eIF2C 1, eIF-2C 1, Eukaryotic translation initiation factor 2C 1, eukaryotic translation initiation factor 2C, 1, GERP95, Golgi Endoplasmic Reticulum protein 95 kDa, hAgo1, protein argonaute-1, Putative RNA-binding protein Q99 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?