missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aggrecan Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33191-20ul
This item is not returnable.
View return policy
Description
Aggrecan Monoclonal antibody specifically detects Aggrecan in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| Aggrecan | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16AGCAN | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 761-861 of human Aggrecan (P16112).,, Sequence:, WPPTGAATEESTEGPSATEVPSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEEPYTPSPPVPSWTELPSSGEES | |
| 20 μL | |
| Extracellular Matrix, Growth and Development, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Stem Cell Markers | |
| 176 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction