missing translation for 'onlineSavingsMsg'
Learn More

AGER Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18363133
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18363133 25 μg 25µL
18397992 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18363133 Supplier Bio-Techne Supplier No. NBP31698125UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

AGER Polyclonal antibody specifically detects AGER in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen AGER
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias advanced glycosylation end product-specific receptor, RAGE isoform delta, RAGE isoform sRAGE-delta, Receptor for advanced glycosylation end products, receptor for advanced glycosylation end-products
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNG
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 177
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.