missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AGAP2 Polyclonal antibody specifically detects AGAP2 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | AGAP2 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | AGAP-2, ArfGAP with GTPase domain, ankyrin repeat and PH domain 2, arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2, centaurin, gamma 1, centaurin-gamma-1, CENTG1, Cnt-g1, FLJ16430, GGAP2, GTP-binding and GTPase activating protein 2, GTP-binding and GTPase-activating protein 2, KIAA0167, Phosphatidylinositol-3-kinase enhancer, phosphoinositide 3-kinase enhancer, PIKEArf GAP with GTP-binding protein-like, ANK repeat and PH domains 2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?