missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
AF10 Monoclonal antibody specifically detects AF10 in Human, Rat samples. It is validated for Western Blot, ELISA
Specifications
Specifications
| Antigen | AF10 |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 2B9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot, ELISA |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | AF10MGC75086, ALL1-fused gene from chromosome 10 protein, DKFZp686E10210, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog),translocated to, 10, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 10, protein AF-10, type I AF10 protein |
| Host Species | Mouse |
| Immunogen | MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?