Adrenomedullin R/ADMR/GPR182 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90231-25ul

Product Code. 18449621

Description

Adrenomedullin R/ADMR/GPR182 Polyclonal specifically detects Adrenomedullin R/ADMR/GPR182 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Adrenomedullin R/ADMR/GPR182
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ADMR, adrenomedullin receptor, AMR, AM-R, G protein-coupled receptor 182,7TMR, G10D, gamrh, G-protein coupled receptor 182, hrhAMR, MGC34399
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GPR182
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 11318
• Target Species: Human
• Isotype: IgG

For Research Use Only