missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADPRM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79668
This item is not returnable.
View return policy
Description
ADPRM Polyclonal specifically detects ADPRM in Human samples. It is validated for Western Blot.
Specifications
| ADPRM | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| ADPRibase-Mn, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, ADPRM, C17orf48, chromosome 17 open reading frame 48, manganese-dependent ADP-ribose/CDP-alcohol diphosphatase, MDS006, NBLA03831 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 56985 | |
| Human, Equine | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_064618 | |
| ADPRM | |
| Synthetic peptide directed towards the N terminal of human C17orf48The immunogen for this antibody is C17ORF48. Peptide sequence MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction