missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADPRM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADPRM |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADPRM Polyclonal specifically detects ADPRM in Human samples. It is validated for Western Blot.Specifications
| ADPRM | |
| Polyclonal | |
| Rabbit | |
| ADPRibase-Mn, ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent, ADPRM, C17orf48, chromosome 17 open reading frame 48, manganese-dependent ADP-ribose/CDP-alcohol diphosphatase, MDS006, NBLA03831 | |
| ADPRM | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 56985 | |
| Synthetic peptides corresponding to C17ORF48 The peptide sequence was selected from the middle region of C17orf48. Peptide sequence KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title