missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ADPRHL2 Antibody, Novus Biologicals™

ADPRHL2 Antibody, Novus Biologicals™

Product Code. 18413841 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
25 μL
missing translation for 'unitSize'
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18413841 25 μL 25µL
18229346 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18413841 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP18883425ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

ADPRHL2 Polyclonal specifically detects ADPRHL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADPRHL2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9NX46
Gene Alias [Protein ADP-ribosylarginine] hydrolase-like protein 2, ADP-ribosylhydrolase 3, ADP-ribosylhydrolase like 2, ARH3EC 3.2.1.143, FLJ20446, poly(ADP-ribose) glycohydrolase ARH3, protein ADP-ribosylarginine hydrolase-like protein 2
Gene Symbols ADPRHL2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 54936
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.