missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18370829

AdipoR1 Antibody (2C8), Novus Biologicals™

Product Code. 18370829 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18370829 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18370829 Supplier Novus Biologicals Supplier No. H00051094M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

AdipoR1 Monoclonal antibody specifically detects AdipoR1 in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen AdipoR1
Applications ELISA
Classification Monoclonal
Clone 2C8
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057083
Gene Alias ACDCR1, adiponectin receptor 1, adiponectin receptor protein 1, ADR1, CGI45, FLJ42464, PAQR1FLJ25385, Progestin and adipoQ receptor family member I, TESBP1A
Host Species Mouse
Immunogen ADIPOR1 (NP_057083.2, 72 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51094
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.