missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Adenylate Cyclase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £359.00
Specifications
| Antigen | Adenylate Cyclase 5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18384975
|
Novus Biologicals
NBP3-10868-25UL |
25 μg |
£161.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18333224
|
Novus Biologicals
NBP3-10868-100UL |
100 μg |
£359.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Adenylate Cyclase 5 Polyclonal specifically detects Adenylate Cyclase 5 in Human samples. It is validated for Western Blot.Specifications
| Adenylate Cyclase 5 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 111 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Adenylate Cyclase 5 (NP_001186571.1). Peptide sequence EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title