missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Adenylate Cyclase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Adenylate Cyclase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Código de producto. 18333224 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
100 μg
25 μg
Tamaño de la unidad:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18333224 100 μg 100µL
18384975 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18333224 Proveedor Novus Biologicals N.º de proveedor NBP310868100UL

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

Adenylate Cyclase 5 Polyclonal specifically detects Adenylate Cyclase 5 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen Adenylate Cyclase 5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human Adenylate Cyclase 5 (NP_001186571.1). Peptide sequence EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 111
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.