Adenylate Cyclase 5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10868-100UL

Product Code. 18333224

Description

Adenylate Cyclase 5 Polyclonal specifically detects Adenylate Cyclase 5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Adenylate Cyclase 5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AC5, adenylate cyclase 5, adenylate cyclase type 5, Adenylate cyclase type V, Adenylyl cyclase 5, ATP pyrophosphate-lyase 5, EC 4.6.1.1
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Adenylate Cyclase 5 (NP_001186571.1). Peptide sequence EELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
• Quantity: 100 μg
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 111
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified