missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Adenosylhomocysteinase/AHCY Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48817-25ul
This item is not returnable.
View return policy
Description
Adenosylhomocysteinase/AHCY Polyclonal antibody specifically detects Adenosylhomocysteinase/AHCY in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Adenosylhomocysteinase/AHCY | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| adenosylhomocysteinase, AdoHcyase, EC 3.3.1.1, S-adenosylhomocysteine hydrolase, S-adenosyl-L-homocysteine hydrolase, SAHHadoHcyase | |
| This antibody was developed against a recombinant protein corresponding to amino acids: HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY | |
| 25 μL | |
| Amino Acids Drugs and other smAll species molecules, Endocrinology, Signal Transduction | |
| 191 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction