Adenosylhomocysteinase/AHCY Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48817

Product Code. 18665028

Description

Adenosylhomocysteinase/AHCY Polyclonal antibody specifically detects Adenosylhomocysteinase/AHCY in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Adenosylhomocysteinase/AHCY
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: adenosylhomocysteinase, AdoHcyase, EC 3.3.1.1, S-adenosylhomocysteine hydrolase, S-adenosyl-L-homocysteine hydrolase, SAHHadoHcyase
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY
• Quantity: 0.1 mL
• Research Discipline: Amino Acids Drugs and other smAll species molecules, Endocrinology, Signal Transduction
• Gene ID (Entrez): 191
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified