missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18369911

Adenine Nucleotide Translocator 2 Antibody, Novus Biologicals™

Product Code. 18369911 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369911 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369911 Supplier Novus Biologicals Supplier No. NBP312220

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Adenine Nucleotide Translocator 2 Polyclonal antibody specifically detects Adenine Nucleotide Translocator 2 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Adenine Nucleotide Translocator 2
Applications Western Blot, ELISA, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:10000, Immunohistochemistry 1:100, Immunocytochemistry/Immunofluorescence 1:100, Immunoprecipitation 1:200, Immunohistochemistry-Paraffin
Formulation Contains Tris, HCl/glycine buffer (pH 7.4-7.8), 30% glycerol, 0.5% BSA, along with cryo-protective agents, and HEPES (exact storage and stabilization buffer information is proprietary) with 0.02% Sodium Azide
Gene Alias Adenine nucleotide translocator 2, adenine nucleotide translocator 2 (fibroblast), ADP, ADP/ATP carrier protein, ADP/ATP translocase 2, ANT2AAC2, 2F1, ATP carrier protein 2, ATP carrier protein, fibroblast isoform, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 5, Solute carrier family 25 member 5, T2, T3ANT 2
Host Species Rabbit
Immunogen Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2. Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Purification Method Affinity-purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 292
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.