missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTSL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£222.00 - £486.00
Specifications
| Antigen | ADAMTSL5 |
|---|---|
| Dilution | Western Blot 1:100-1:500, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18433061
|
Novus Biologicals
NBP1-93438-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18095795
|
Novus Biologicals
NBP1-93438 |
0.1 mL |
£486.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ADAMTSL5 Polyclonal specifically detects ADAMTSL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| ADAMTSL5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ADAMTSL-5, ADAMTS-like 5, ADAMTS-like protein 5, thrombospondin type-1 domain-containing protein 6, thrombospondin, type I, domain containing 6, THSD6 | |
| ADAMTSL5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:100-1:500, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q6ZMM2 | |
| 339366 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AHRLLHYCGSDFVFQARVLGHHHQAQETRYEVRIQLVYKNRSPLRAREYVWAPGHCPCPMLAPHRDYLMAVQRLVSPDGTQDQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title