missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTS4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | ADAMTS4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18244255
|
Novus Biologicals
NBP2-56239 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18690949
|
Novus Biologicals
NBP2-56239-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ADAMTS4 Polyclonal specifically detects ADAMTS4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ADAMTS4 | |
| Polyclonal | |
| Rabbit | |
| Cancer, GPCR, Neuroscience, Vision | |
| a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 4, ADAM metallopeptidase with thrombospondin type 1 motif, 4, ADAM-TS 4, ADAMTS-2, ADAM-TS4, ADAMTS-4, ADMP-1EC 3.4.24.82, aggrecanase-1, EC 3.4.24, KIAA0688A disintegrin and metalloproteinase with thrombospondin motifs 4 | |
| ADAMTS4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 9507 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title