ADAMTS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-30775-25ul

Product Code. 18453172

Description

ADAMTS3 Polyclonal specifically detects ADAMTS3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ADAMTS3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: O15072
• Gene Symbols: ADAMTS3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A disintegrin and metalloproteinase with thrombospondin motifs 3, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3, ADAM metallopeptidase with thrombospondin type 1 motif, 3, ADAM-TS 3, ADAM-TS3, ADAMTS-3, ADAMTS-4, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, KIAA0366PC II-NP, Procollagen II amino propeptide-processing enzyme, Procollagen II N-proteinase, zinc metalloendopeptidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9508
• Target Species: Human
• Isotype: IgG

For Research Use Only