missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18396238

ADAMTS3 Antibody (1D6), Novus Biologicals™

Product Code. 18396238 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18396238 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18396238 Supplier Novus Biologicals Supplier No. H00009508M08

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ADAMTS3 Monoclonal antibody specifically detects ADAMTS3 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADAMTS3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1D6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055058.1
Gene Alias A disintegrin and metalloproteinase with thrombospondin motifs 3, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3, ADAM metallopeptidase with thrombospondin type 1 motif, 3, ADAM-TS 3, ADAM-TS3, ADAMTS-3, ADAMTS-4, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, KIAA0366PC II-NP, Procollagen II amino propeptide-processing enzyme, Procollagen II N-proteinase, zinc metalloendopeptidase
Host Species Mouse
Immunogen ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN
Purification Method IgG purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9508
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.