missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17208-25UL
This item is not returnable.
View return policy
Description
ADAMTS2 Polyclonal antibody specifically detects ADAMTS2 in Human samples. It is validated for Immunofluorescence
Specifications
| ADAMTS2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| A disintegrin and metalloproteinase with thrombospondin motifs 2, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 2, ADAM metallopeptidase with thrombospondin type 1 motif, 2, ADAM-TS 2, ADAMTS-2, ADAM-TS2EC 3.4.24.14, ADAMTS-3, EC 3.4.24, NPIDKFZp686F12218, PC I-NP, PCI-NP, PCINPhPCPNI, PCPNI, pNPI, Procollagen I N-proteinase, Procollagen I/II amino propeptide-processing enzyme, Procollagen N-endopeptidase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV | |
| 25 μg | |
| Angiogenesis, Cancer, Extracellular Matrix | |
| 9509 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction