missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAMTS18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ADAMTS18 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ADAMTS18 Polyclonal specifically detects ADAMTS18 in Human samples. It is validated for Western Blot.Specifications
| ADAMTS18 | |
| Polyclonal | |
| Rabbit | |
| Q8TE60 | |
| 170692 | |
| Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif, 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| A disintegrin and metalloproteinase with thrombospondin motifs 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21, ADAM metallopeptidase with thrombospondin type 1 motif, 18, ADAM-TS 18, ADAM-TS18, ADAMTS-18, ADAMTS21, disintegrin and metalloprotease-like protein, EC 3.4.24.-, EC 3.4.24.82 | |
| ADAMTS18 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title