missing translation for 'onlineSavingsMsg'
Learn More

ADAM29 Antibody (3A6), Novus Biologicals™

Product Code. 18410030 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18410030 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18410030 Supplier Novus Biologicals Supplier No. H00011086M09

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ADAM29 Monoclonal antibody specifically detects ADAM29 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Frozen), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ADAM29
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Frozen), Sandwich ELISA
Classification Monoclonal
Clone 3A6
Conjugate Unconjugated
Dilution Western Blot 1:100 to 1:2000, ELISA 1:100 to 1:2000, Immunohistochemistry, Immunohistochemistry-Frozen, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055084
Gene Alias ADAM 29, ADAM metallopeptidase domain 29, Cancer/testis antigen 73, CT73a disintegrin and metalloproteinase domain 29, disintegrin and metalloproteinase domain-containing protein 29, EC 3.4.24, EC 3.4.24.58, svph1
Host Species Mouse
Immunogen ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11086
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.