Invitrogen™ ADAM28 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA578726

Product Code. 15904315

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, K562 whole cell.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. Alternative splicing results in two transcript variants. The shorter version encodes a secreted isoform, while the longer version encodes a transmembrane isoform.

Specifications

• Antigen: ADAM28
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ADAM28
• Gene Alias: a disintegrin and metallopeptidase domain 28; a disintegrin and metalloprotease domain 28; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 28; ADAM; ADAM 28; ADAM metallopeptidase domain 28; ADAM23; Adam28; ADAMs; C130072N01Rik; D430033C21Rik; disintegrin 1; disintegrin and metalloproteinase domain-containing protein 28; Dtgn1; eMDC II; eMDCII; Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; MDCL; MDC-L; MDC-Lm; MDC-Ls; metalloendopeptidases; metalloproteinase-disintegrin domain containing protein TECADAM; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L; metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L; TECADAM; Thymic epithelial cell-ADAM
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10863
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q9UKQ2
• Gene Symbols: ADAM28
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG