missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ADAM19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 3 publications
Brand: Novus Biologicals NBP1-69364
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
ADAM19 Polyclonal specifically detects ADAM19 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
Spécification
| ADAM19 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| a disintegrin and metalloproteinase domain 19 (meltrin beta), ADAM 19, ADAM metallopeptidase domain 19, disintegrin and metalloproteinase domain-containing protein 19, EC 3.4.24, EC 3.4.24.-, MADDAM, Meltrin-beta, Metalloprotease and disintegrin dendritic antigen marker, MLTNBmeltrin beta | |
| Rabbit | |
| 82 kDa | |
| 100 μL | |
| Dendritic Cell Markers | |
| 8728 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500 | |
| Q9H013 | |
| ADAM19 | |
| Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu