ADAL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17207-100UL

Product Code. 18335244

Description

ADAL Polyclonal antibody specifically detects ADAL in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: ADAL
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: adenosine deaminase-like, adenosine deaminase-like protein, DKFZp313B2137, EC 3.5.4, EC 3.5.4.-, FLJ44620
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
• Quantity: 100 μg
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 161823
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified