missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTRT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ACTRT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACTRT1 Polyclonal specifically detects ACTRT1 in Human samples. It is validated for Western Blot.Specifications
| ACTRT1 | |
| Polyclonal | |
| Rabbit | |
| Q8TDG2 | |
| 139741 | |
| Synthetic peptides corresponding to ACTRT1 (actin-related protein T1) The peptide sequence was selected from the middle region of ACTRT1. Peptide sequence DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| actin-related protein T1, AIP1, ARIP1, ARP-T1, ARPT1HSD27, KIAA0705, MGC26590 | |
| ACTRT1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title