HSD11B1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55319-25ul

Product Code. 18677858

Description

HSD11B1L Polyclonal specifically detects HSD11B1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HSD11B1L
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: 11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short chain dehydrogenase/reductase family 26C, member 2, Short-chain dehydrogenase/reductase 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HSD11B1L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 374875
• Target Species: Human
• Isotype: IgG

For Research Use Only