missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTL9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ACTL9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACTL9 Polyclonal specifically detects ACTL9 in Human samples. It is validated for Western Blot.Specifications
| ACTL9 | |
| Polyclonal | |
| Rabbit | |
| Q8TC94 | |
| 284382 | |
| Synthetic peptides corresponding to MGC33407(hypothetical protein MGC33407) The peptide sequence was selected from the middle region of MGC33407. Peptide sequence DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| actin-like 9, actin-like protein 9, ACTL7C, MGC33407 | |
| ACTL9 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title