missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACTL6B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55478
This item is not returnable.
View return policy
Description
ACTL6B Polyclonal specifically detects ACTL6B in Human samples. It is validated for Western Blot.
Specifications
| ACTL6B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 53 kDa BRG1-associated factor B, actin-like 6, actin-like 6B, Actin-related protein Baf53b, ACTL6, ArpNalpha, BAF53Bactin-like protein 6B, BRG1-associated factor 53B, hArpN alpha | |
| Rabbit | |
| 47 kDa | |
| 100 μL | |
| Extracellular Matrix | |
| 51412 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O94805 | |
| ACTL6B | |
| Synthetic peptides corresponding to ACTL6B(actin-like 6B) The peptide sequence was selected from the middle region of ACTL6B. Peptide sequence GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction