missing translation for 'onlineSavingsMsg'
Learn More
Learn More
actin-related protein 2/3 complex subunit 1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
£181.00 - £459.00
Specifications
| Antigen | actin-related protein 2/3 complex subunit 1B |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489631
|
Novus Biologicals
NBP1-90114-25ul |
25 μL |
£181.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18299737
|
Novus Biologicals
NBP1-90114 |
0.1 mL |
£459.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
actin-related protein 2/3 complex subunit 1B Polyclonal specifically detects actin-related protein 2/3 complex subunit 1B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| actin-related protein 2/3 complex subunit 1B | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| actin related protein 2/3 complex, subunit 1B (41 kD), actin related protein 2/3 complex, subunit 1B, 41kDa, actin-related protein 2/3 complex subunit 1B, ARC41p41-ARCp40-ARC, Arp2/3 complex 41 kDa subunit, ARP2/3 protein complex subunit p41 | |
| ARPC1B | |
| IgG | |
| Affinity Purified | |
| Specificity of human actin-related protein 2/3 complex subunit 1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| O15143 | |
| 10095 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 41 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title