ACSM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18451912	Novus Biologicals NBP1-91645-25ul	25 μL
18298059	Novus Biologicals NBP1-91645	0.1 mL

Description

ACSM1 Polyclonal specifically detects ACSM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ACSM1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: acyl-CoA synthetase medium-chain family member 1EC 6.2.1.2, acyl-coenzyme A synthetase ACSM1, mitochondrial, BUCS1, Butyrate CoA ligase, Butyrate--CoA ligase 1, butyryl Coenzyme A synthetase 1, Butyryl-coenzyme A synthetase 1, EC 6.2.1, LAE, Lipoate-activating enzyme, MACS1MGC150532, medium-chain acyl-CoA synthetase, Middle-chain acyl-CoA synthetase 1
• Gene Symbols: ACSM1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q08AH1
• Gene ID (Entrez): 116285
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only