missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ ACSL5 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA578714
This item is not returnable.
View return policy
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, mouse liver tissue. Flow: HepG2 cell.
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.
Specifications
| ACSL5 | |
| Polyclonal | |
| Unconjugated | |
| ACSL5 | |
| 1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083 | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 433256, 51703, 94340 | |
| -20°C | |
| Lyophilized |
| Flow Cytometry, Western Blot | |
| 500 μg/mL | |
| Antibody with 4mg trehalose, 0.9mg NaCl, 0.2mg Na2PO4 and no preservative | |
| O88813, Q8JZR0, Q9ULC5 | |
| ACSL5 | |
| A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction