ACSL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35183-20ul

Product Code. 30227778

Description

ACSL3 Polyclonal antibody specifically detects ACSL3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: ACSL3
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ACS3EC 6.2.1.3, acyl-CoA synthetase long-chain family member 3, FACL3lignoceroyl-CoA synthase, fatty-acid-Coenzyme A ligase, long-chain 3, LACS 3, LACS3, Long-chain acyl-CoA synthetase 3, long-chain-fatty-acid--CoA ligase 3, PRO2194
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 621-720 of human ACSL3 (NP_004448.2).,, Sequence:, VIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
• Quantity: 20 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 2181
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified