ACSF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP2-47558-25ul

Artikelnummer. 18670216

Beschreibung

ACSF2 Polyclonal specifically detects ACSF2 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: ACSF2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: ACSMW, acyl-CoA synthetase family member 2, AVYV493, EC 6.2.1, EC 6.2.1.-, EC 6.2.1.26, mitochondrial, PPARG binding, long chain fatty acid acyl Co-A ligase like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ACSF2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGEN
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 80221
• Target Species: Human
• Isotype: IgG

For Research Use Only