missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACSBG2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ACSBG2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ACSBG2 Polyclonal specifically detects ACSBG2 in Human, Mouse samples. It is validated for Western Blot.Specifications
| ACSBG2 | |
| Polyclonal | |
| Rabbit | |
| acyl-CoA synthetase bubblegum family member 2BRGL, BGRMGC111089, Bubblegum-related protein, DKFZp434K1635, EC 6.2.1.3, long-chain-fatty-acid--CoA ligase ACSBG2, PRTD-NY3PRTDNY3 | |
| ACSBG2 | |
| IgG | |
| 68 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 81616 | |
| Synthetic peptides corresponding to ACSBG2(acyl-CoA synthetase bubblegum family member 2) The peptide sequence was selected from the middle region of ACSBG2. Peptide sequence LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title