ACSBG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58214

Code produit. 18276381

Description

ACSBG1 Polyclonal specifically detects ACSBG1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Spécification

• Antigen: ACSBG1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: acyl-CoA synthetase bubblegum family member 1EC 6.2.1.3, BG1, BGMBG, bubblegum, FLJ30320, hBG1, hsBG, hsBGM, KIAA0631GR-LACS, lipidosin, long-chain-fatty-acid--CoA ligase ACSBG1, LPD, MGC14352, very long-chain acyl-CoA synthetase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACSBG1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILER
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 23205
• Target Species: Human
• Isotype: IgG

For Research Use Only