missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18329139

ACOT8 Antibody, Novus Biologicals™

Product Code. 18329139 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18329139 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18329139 Supplier Novus Biologicals Supplier No. H00010005B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

ACOT8 Polyclonal antibody specifically detects ACOT8 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ACOT8
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Immunocytochemistry/ Immunofluorescence
Formulation PBS (pH 7.4)
Gene Accession No. NP_005460.2
Gene Alias ACTEIII, acyl-CoA thioesterase 8HNAACTE, Choloyl-coenzyme A thioesterase, EC 3.1.2.27, hACTEIII, HIV-Nef-associated acyl-CoA thioesterase, hTEcholoyl-CoA hydrolase, long-chain fatty-acyl-CoA hydrolase, palmitoyl-CoA hydrolase, peroxisomal acyl-CoA thioesterase, peroxisomal acyl-CoA thioesterase 1, Peroxisomal acyl-coenzyme A thioester hydrolase 1, Peroxisomal long-chain acyl-CoA thioesterase 1, PTE-1, PTE1HIV-Nef associated acyl-CoA thioesterase, PTE2, PTE-2hACTE-IIIacyl-coenzyme A thioesterase 8, Thioesterase II, thioesterase III
Host Species Mouse
Immunogen ACOT8 (NP_005460.2, 1 a.a. - 319 a.a.) full-length human protein. MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Immunology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10005
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.